PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009601056.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 404aa    MW: 44312.2 Da    PI: 4.8267
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009601056.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.15.5e-06444539
        zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                    +C+ ++e++ + +C+++  +lC +C  + H+       H++
  XP_009601056.1  4 TCEFCGEQRSIVYCRSDAACLCLSCDRHVHSAnalsqrHSR 44
                    7*****************************65677777765 PP

2zf-B_box29.31.8e-094688440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                     +C++++++++++ C +++  lC++C   +H +      H+++
  XP_009601056.1 46 LVCERCNSQPAIFRCDEDRISLCQNCDWIGHANsssgstHKRQ 88
                    68*****************************888888999876 PP

3CCT61.33.2e-21347390144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     R  a+lRYkeK+ktR+F+K++rY+sRKa+A+ R RvKGrFvk+ 
  XP_009601056.1 347 RSDAVLRYKEKKKTRQFDKRVRYASRKARADVRRRVKGRFVKAG 390
                     889**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003364.8E-7447IPR000315B-box-type zinc finger
CDDcd000218.29E-7547No hitNo description
PROSITE profilePS501199.129547IPR000315B-box-type zinc finger
PROSITE profilePS501199.2864390IPR000315B-box-type zinc finger
PfamPF006431.3E-54687IPR000315B-box-type zinc finger
CDDcd000212.26E-44790No hitNo description
SMARTSM003361.34890IPR000315B-box-type zinc finger
PfamPF062036.9E-16347389IPR010402CCT domain
PROSITE profilePS5101715.16347389IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MGFTCEFCGE QRSIVYCRSD AACLCLSCDR HVHSANALSQ RHSRTLVCER CNSQPAIFRC  60
DEDRISLCQN CDWIGHANSS SGSTHKRQAL SCYTGCPSAV ELSVIWSFLL DNPSVGDSTC  120
EQGMSSMSIT DCRPGDSRGS QAKDKSQDMS VAVEANDLMG SLMLSLDSKL HNVEPPVGST  180
NLTWSKVSNS ATKGSNIFDD DRFYDDFNMD EVDLSIETYE ELFGVSLDNP DQLFKNEDID  240
GLFGMKDMPV AESSCQGDTA VEGSALGRVN TVQPACSNAA SAESTMSCKT EPTLCFARQQ  300
SNLSVSNLTG ESSAGDYQDC GASSMLLMGE PPWCSPCPES SMPSTSRSDA VLRYKEKKKT  360
RQFDKRVRYA SRKARADVRR RVKGRFVKAG DAYDYDPLSE TRSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009601056.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 9-like
SwissprotQ9LUA91e-134COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLM1BGT70.0M1BGT7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000448770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12702468
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-112B-box type zinc finger protein with CCT domain